SAMS PEPTIDE(125911-68-4)
- Name: SAMS PEPTIDE
- Synonyms:15:PN: US6455292 SEQID: 15 unclaimed sequence; 19: PN: WO03056032 SEQID: 31unclaimed sequence; 1: PN: WO2006088315 PAGE: 54 unclaimed sequence; 20: PN:WO2006135762 SEQID: 20 unclaimed sequence; 32: PN: WO2009088779 SEQID: 33unclaimed sequence; 50: PN: US20060246418 SEQID: 50 unclaimed sequence; 58: PN:US20030124590 SEQID: 63 unclaimed sequence; 5: PN: JP2007082508 SEQID: 6unclaimed sequence; 5: PN: WO2009094058 SEQID: 7 unclaimed protein; 7: PN:US20060147947 SEQID: 7 unclaimed sequence; 7: PN: WO2004050898 SEQID: 7unclaimed sequence; SAMS
- Molecular Formula:C74H131 N29 O18 S2
- Molecular Weight:1779.15
- CAS Registry Number:125911-68-4
- EINECS:
- Melting Point:
- Water Solubility:
CAS No.125911-68-4 SAMS PEPTIDE
Assay:99% Package:According client's requirements Transportation:by sea/by air/by courier Application:Chemical products
Min. Order:1Kilogram
Supplier:Hangzhou ZeErRui Chemical Co., Ltd. [
China (Mainland)]
CAS No.125911-68-4 SAMS PEPTIDE
Assay:99% Appearance:powder Package:Inside plastic outside Storage:Store at -20掳C Transportation:We ship goods via DHL, Fedex, UPS, TNT, China post, NL Post and other couriers, weight from 1g to 1000kg or even bulker Application:Scientific research
Min. Order:1Gram
Supplier:Hebei Nengqian Chemical Import and Export Co., LTD [
China (Mainland)]
CAS No.125911-68-4 SAMS PEPTIDE
Assay:99% Appearance:powder or liquid Package:according to customer requirements Storage:store in dry dark and ventilated place Transportation:By Sea/Air/Courier Application:It is an important raw material.
Min. Order:10Gram
Supplier:Zibo Hangyu Biotechnology Development Co., Ltd [
China (Mainland)]
CAS No.125911-68-4 SAMSpeptide
Assay:99.0% Appearance:liquid Package:Grams, Kilograms Storage:Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials. Transportation:According to customer request Application:For R&D and commerical use
Min. Order:100Gram
Supplier:Chemlyte Solutions [
China (Mainland)]
CAS No.125911-68-4 SAMS PEPTIDE
Assay:90%,98% Appearance:detailed see specifications Package:according to the clients requirement Storage:Store in dry, dark and ventilated place. Transportation:by air or by sea Application:Used in Synthesis, Pharmaceuticals and other fields
Min. Order:1Kilogram
Supplier:Dayang Chem (Hangzhou) Co.,Ltd. [
China (Mainland)]
CAS No.125911-68-4 SaMs peptide
Assay:0.98 Appearance:Off white to slight yellow solid Package:1L 5L 10L 25L bottle Storage:Stored in shaded, cool and dry places Transportation:Handle with cares to avoid damaging the packages. Protect them from sunshine or rain. We can send by Fedex, by ship or by plane according to international rules. Application:pharma intermediate
Min. Order:0
Supplier:Antimex Chemical Limied [
China (Mainland)]
CAS No.125911-68-4 SAMS PEPTIDE
Assay:99% Application:Used as pharmaceutical intermediate
Min. Order:0
Supplier:Shandong Hanjiang Chemical Co., Ltd. [
China (Mainland)]
CAS No.125911-68-4 SAMS PEPTIDE
Assay:99% Package:box or opp package Storage:cool drum Transportation:air or sea Application:SAMS PEPTIDE
Min. Order:1Milligram
Supplier:weifang yangxu group co.,ltd [
China (Mainland)]
CAS No.125911-68-4 SAMS PEPTIDE
Assay:99% Appearance:liquid or powder Package:according to the clients requirement Storage:Dry and Cool Place Transportation:UPS FedEx ,DHL,EXPRESS LINE Application:API
Min. Order:1Gram
Supplier:Shandong Mopai Biotechnology Co., LTD [
China (Mainland)]
CAS No.125911-68-4 L-Arginine,L-histidyl-L-methionyl-L-arginyl-L-seryl-L-alanyl-L-methionyl-L-serylglycyl-L-leucyl-L-histidyl-L-leucyl-L-valyl-L-lysyl-L-arginyl-
Assay:97% Appearance:Powder or liquid Package:According to customer Storage:Store in a tightly closed container, in a cool and dry place. Transportation:Fedex,DHL,TNT,BY SEA and BY AIR Application:Medicinal Chemistry Biomedicine Pharmaceutical intermediates Chemistry experiment Biological experiments Chemical reagent For R&D use only.
Min. Order:10Milligram
Supplier:Amadis Chemical Co., Ltd. [
China (Mainland)]
CAS No.125911-68-4 SAMS Peptide
Assay:99% Appearance:powder Package:1kg/bag; 101kg/drum, or as customer's required Storage:Keep in a cool & dry place Transportation:by air/by sea Application:lab
Min. Order:0Metric Ton
Supplier:Jiangsu Congzhong Chemical Co., Ltd. [
China (Mainland)]
CAS No.125911-68-4 125911-68-4
Assay:98.5% Appearance:white/off-white or light yellow Package:aluminum bottle,glass bottle,PTFE bottle,cardboard drum Storage:Store in cool and dry place, keep away from strong light and heat. Transportation:by courier, by air, by sea Application:This product can be used in food/pharmaceutical/cosmetical industry
Min. Order:0
Supplier:Suzhou Health Chemicals Co., Ltd. [
China (Mainland)]
CAS No.125911-68-4 HIS-MET-ARG-SER-ALA-MET-SER-GLY-LEU-HIS-LEU-VAL-LYS-ARG-ARG
Assay:98% Appearance:white powder Package:1mg Storage:Keep it in dry,shady and cool place Transportation:by express or by sea Application:Pharma;Industry;Agricultural;chemical reaserch
Min. Order:0
Supplier:Shanghai Yuanye Bio-Technology Co., Ltd. [
China (Mainland)]
CAS No.125911-68-4 SAMS
Assay:>95% Appearance:White or Off-white Lyophilized Powder Storage:Store at -20掳C Application:For research use only.
Min. Order:0
Supplier:BOC Sciences [
United States]
CAS No.125911-68-4 SAMS PEPTIDE
Assay:98% Package:According to the demand of customer Storage:Sealed, dry, microtherm , avoid light and smell. Transportation:by air or by sea Application:Organic synthesis
Min. Order:0
Supplier:Henan Allgreen Chemical Co.,Ltd [
China (Mainland)]

Other Product
- 393-85-1/2-NITRO-5-FLUOROBENZOIC ACID, METHYL ESTER
- 169396-88-7/N-[2-(FMOC-AMINO)-ETHYL]GLYCINE TERT-BUTYL ESTER HYDROCHLORIDE
- 235-21-2/[1,2,3]Triazolo[1,5-a]quinoline
- 166108-71-0/[2-[2-(Fmoc-amino)ethoxy]ethoxy]acetic acid
- 78539-91-0/7-METHYL-1,2,3-TRIAZOLO(1,5-A)PYRIDINE
- 72648-80-7/ETHYL [2-(BOC-AMINO)ETHYLAMINO]ACETATE HYDROCHLORIDE
- 195986-91-5/5-HYDROXY ISATOIC ANHYDRIDE
- 169287-77-8/BOC-PNA-G(Z)-OH
- 947-88-6/3-(2-PYRIDYL)-1,2,3-TRIAZOLO(1,5-A)PYRIDINE
- 139166-80-6/BOC-PNA-T-OH
- 2032-75-9/2,2-Dichloro-1,3-benzodioxole
- 27428-57-5/4-BROMO-4'-CHLOROBENZOPHENONE
- 32665-23-9/FEMA 2961
- 5892-11-5/BRUCINE
- 55750-62-4/N-Succinimidyl 3-maleimidopropionate
- 209127-01-5/1-(4-Fluorphenyl)-2-methyl-2-morpholino-1-propanone
- 15445-77-9/FMOC-ARG(PBF)-OH
- 129121-73-9/ALPHA-CGRP (8-37) (RAT)
- 92000-76-5/HA PEPTIDE
- 125911-68-4/SAMS PEPTIDE
- 73572-58-4/BOC-PHE-D-LEU-PHE-D-LEU-PHE-OH
- 187986-11-4/H-TRP-LYS-TYR-MET-VAL-MET-NH2
- 10010-67-0/Sodium hydrogen piperazine-1,4-diethanesulphonate
- 100930-02-7/ARG-TYR-LEU-PRO-THR ACETATE SALT
- 183598-56-3/LEPTIN (22-56), HUMAN
- 357952-10-4/FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
- 102029-74-3/H-TYR-PRO-PHE-VAL-GLU-PRO-ILE-OH
- 217082-58-1/GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE
- 123338-10-3/ALLATOSTATIN I
- 357952-09-1/STRESSCOPIN (3-40) (HUMAN) TRIFLUOROACETATE SALT