LEPTIN (22-56), HUMAN(183598-56-3)
- Name: LEPTIN (22-56), HUMAN
- Synonyms:1018:PN: US20090175821 SEQID: 1286 claimed protein; 596: PN: WO0069900 SEQID: 1286unclaimed protein; Leptin(22-56) (human)
- Molecular Formula:C171H298 N50 O56
- Molecular Weight:0
- CAS Registry Number:183598-56-3
- EINECS:
- Melting Point:
- Water Solubility:
CAS No.183598-56-3 L-Lysine,L-valyl-L-prolyl-L-isoleucyl-L-glutaminyl-L-lysyl-L-valyl-L-glutaminyl-L-a-aspartyl-L-a-aspartyl-L-threonyl-L-lysyl-L-threonyl-L-leucyl-L-isoleucyl-L-lysyl-L-threonyl-L-isoleucyl-L-valyl-L-th
Assay:99% Appearance:powder or liquid Package:according to customer requirements Storage:store in dry dark and ventilated place Transportation:By Sea/Air/Courier Application:It is an important raw material.
Min. Order:10Gram
Supplier:Zibo Hangyu Biotechnology Development Co., Ltd [
China (Mainland)]
CAS No.183598-56-3 LEPTIN (22-56), HUMAN
Assay:90%,98% Appearance:detailed see specifications Package:according to the clients requirement Storage:Store in dry, dark and ventilated place. Transportation:by air or by sea Application:Used in Synthesis, Pharmaceuticals and other fields
Min. Order:1Kilogram
Supplier:Dayang Chem (Hangzhou) Co.,Ltd. [
China (Mainland)]
CAS No.183598-56-3 L-Lysine,L-valyl-L-prolyl-L-isoleucyl-L-glutaminyl-L-lysyl-L-valyl-L-glutaminyl-L-a-aspartyl-L-a-aspartyl-L-threonyl-L-lysyl-L-threonyl-L-leucyl-L-isoleucyl-L-lysyl-L-threonyl-L-isoleucyl-L-valyl-L-th
Assay:99.0% Appearance:liquid Package:Grams, Kilograms Storage:Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials. Transportation:According to customer request Application:For R&D and commerical use
Min. Order:100Gram
Supplier:Chemlyte Solutions [
China (Mainland)]
CAS No.183598-56-3 Leptin (22-56)
Assay:98% Application:Chemical intermediate
Min. Order:0
Supplier:HANGZHOU TIANYE CHEMICALS CO., LTD. [
China (Mainland)]
CAS No.183598-56-3 L-Lysine,L-valyl-L-prolyl-L-isoleucyl-L-glutaminyl-L-lysyl-L-valyl-L-glutaminyl-L-a-aspartyl-L-a-aspartyl-L-threonyl-L-lysyl-L-threonyl-L-leucyl-L-isoleucyl-L-lysyl-L-threonyl-L-isoleucyl-L-valyl-L-th
Assay:99% Application:Fine chemical intermediates, used as the main raw material for the synthesis of various pesticides, medicines, surfactants, polymer monomers, and antifungal agents
Min. Order:0
Supplier:Antimex Chemical Limied [
China (Mainland)]
CAS No.183598-56-3 LEPTIN (22-56), HUMAN
Assay:99% Application:Used as pharmaceutical intermediate
Min. Order:0
Supplier:Shandong Hanjiang Chemical Co., Ltd. [
China (Mainland)]
CAS No.183598-56-3 LEPTIN (22-56), HUMAN
Assay:99%+ Package:25kg,50kg,180kg,200kg,250kg,1000kg锛宑ustomization Storage:Keep it in dry,shady and cool place Transportation:Transit could be DHL,UPS,TNT,EMS,Fedex,and so on.For mass orders, it will be delivered by air or sea.For small order, please expect 3-7 days by UPS DHL EMS.For mass order, please allow 5-8 days. Application:Pharma;Industry;Agricultural;chemical reaserch
Min. Order:1Kilogram
Supplier:Wuhan Circle Star Chem-medical Technology co.,Ltd. [
China (Mainland)]
CAS No.183598-56-3 LEPTIN (22-56), HUMAN
Assay:99% Package:box or opp package Storage:cool drum Transportation:air or sea Application:LEPTIN (22-56), HUMAN
Min. Order:1Milligram
Supplier:weifang yangxu group co.,ltd [
China (Mainland)]
CAS No.183598-56-3 L-Lysine,L-valyl-L-prolyl-L-isoleucyl-L-glutaminyl-L-lysyl-L-valyl-L-glutaminyl-L-a-aspartyl-L-a-aspartyl-L-threonyl-L-lysyl-L-threonyl-L-leucyl-L-isoleucyl-L-lysyl-L-threonyl-L-isoleucyl-L-valyl-L-th
Assay:99% Package:drum Transportation:By Sea/Air/DHL Application:chemical
Min. Order:0
Supplier:Henan Wentao Chemical Product Co., Ltd. [
China (Mainland)]
CAS No.183598-56-3 LEPTIN(22-56),HUMAN
Assay:99%min Appearance:Powder Package:PP bags inside,outside aluminium foil bag Storage:Cool dried place Transportation:Express, sea, air, land. Application:Intermediate,peptides
Min. Order:0
Supplier:Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd [
China (Mainland)]
CAS No.183598-56-3 LEPTIN (22-56), HUMAN
Assay:99% Appearance:liquid or powder Package:according to the clients requirement Storage:Dry and Cool Place Transportation:UPS FedEx ,DHL,EXPRESS LINE Application:API
Min. Order:1Gram
Supplier:Shandong Mopai Biotechnology Co., LTD [
China (Mainland)]
CAS No.183598-56-3 Leptin (22-56), human;183598-56-3
Assay:97% Appearance:Powder or liquid Package:According to customer Storage:Store in a tightly closed container, in a cool and dry place. Transportation:Fedex,DHL,TNT,BY SEA and BY AIR Application:Medicinal ChemistryBiomedicinePharmaceutical intermediatesChemistry experimentBiological experimentsChemical reagentFor R&D use only.
Min. Order:10Metric Ton
Supplier:Amadis Chemical Co., Ltd. [
China (Mainland)]
CAS No.183598-56-3 Leptin (22-56) (human)
Assay:99% Appearance:powder Package:1kg/bag; 101kg/drum, or as customer's required Storage:Keep in a cool & dry place Transportation:by air/by sea Application:lab
Min. Order:0Metric Ton
Supplier:Jiangsu Congzhong Chemical Co., Ltd. [
China (Mainland)]
CAS No.183598-56-3 183598-56-3
Assay:98.5% Appearance:white/off-white or light yellow Package:aluminum bottle,glass bottle,PTFE bottle,cardboard drum Storage:Store in cool and dry place, keep away from strong light and heat. Transportation:by courier, by air, by sea Application:This product can be used in food/pharmaceutical/cosmetical industry
Min. Order:0
Supplier:Suzhou Health Chemicals Co., Ltd. [
China (Mainland)]
CAS No.183598-56-3 Leptin (22-56), human
Assay:>95% Appearance:White or Off-white Lyophilized Powder Package:1 mg Storage:Store at -20掳C Application:For research use only.
Min. Order:0
Supplier:BOC Sciences [
United States]

Other Product
- 195986-91-5/5-HYDROXY ISATOIC ANHYDRIDE
- 169287-77-8/BOC-PNA-G(Z)-OH
- 947-88-6/3-(2-PYRIDYL)-1,2,3-TRIAZOLO(1,5-A)PYRIDINE
- 139166-80-6/BOC-PNA-T-OH
- 2032-75-9/2,2-Dichloro-1,3-benzodioxole
- 27428-57-5/4-BROMO-4'-CHLOROBENZOPHENONE
- 32665-23-9/FEMA 2961
- 5892-11-5/BRUCINE
- 55750-62-4/N-Succinimidyl 3-maleimidopropionate
- 209127-01-5/1-(4-Fluorphenyl)-2-methyl-2-morpholino-1-propanone
- 15445-77-9/FMOC-ARG(PBF)-OH
- 129121-73-9/ALPHA-CGRP (8-37) (RAT)
- 92000-76-5/HA PEPTIDE
- 125911-68-4/SAMS PEPTIDE
- 73572-58-4/BOC-PHE-D-LEU-PHE-D-LEU-PHE-OH
- 187986-11-4/H-TRP-LYS-TYR-MET-VAL-MET-NH2
- 10010-67-0/Sodium hydrogen piperazine-1,4-diethanesulphonate
- 100930-02-7/ARG-TYR-LEU-PRO-THR ACETATE SALT
- 183598-56-3/LEPTIN (22-56), HUMAN
- 357952-10-4/FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
- 102029-74-3/H-TYR-PRO-PHE-VAL-GLU-PRO-ILE-OH
- 217082-58-1/GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE
- 123338-10-3/ALLATOSTATIN I
- 357952-09-1/STRESSCOPIN (3-40) (HUMAN) TRIFLUOROACETATE SALT
- 145854-61-1/MASTOPARAN 17
- 68060-49-1/SUBSTANCE P (1-7)
- 4988-64-1/6-MERCAPTOPURINE RIBOSIDE
- 146692-40-2/4,5-DIAMINO-6-THIOURACIL HEMISULFATE
- 824-27-1/4,5-DIAMINO-3-METHYL-6-OXOPYRIMIDINE
- 37390-66-2/2,6-Dichloropurine-2'-deoxyriboside