N-Succinimidyl 3-maleimidopropionate(55750-62-4)
- Name: N-Succinimidyl 3-maleimidopropionate
- Synonyms:1H-Pyrrole-2,5-dione,1-[3-[(2,5-dioxo-1-pyrrolidinyl)oxy]-3-oxopropyl]- (9CI); 3-Maleimidopropionicacid N-hydroxysuccinimide ester; 3-Maleimidopropionic acid hydroxysuccinimideester; BMPS; BMPS (crosslinking agent); N-Succinimidyl3-(N-maleimido)propionate; N-Succinimidyl 3-maleimidopropionate; b-Maleimidopropionic acid N-hydroxysuccinimideester
- Molecular Formula:C11H10 N2 O6
- Molecular Weight:266.21
- CAS Registry Number:55750-62-4
- EINECS:
- Melting Point:168-170 ºC
- Water Solubility:Insoluble in water.
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:95%, 99% Appearance:detailed see specifications Package:according to the clients requirement Storage:Store in dry, dark and ventilated place. Transportation:by air or by sea Application:Multipurpose intermediate
Min. Order:1Kilogram
Supplier:Dayang Chem (Hangzhou) Co.,Ltd. [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:99.5% Appearance:white powder Package:Drum Storage:Room temperature Transportation:Sea/Air Application:Pharmaceutical intermediates
Min. Order:1Metric Ton
Supplier:HENAN NEW BLUE CHEMICAL CO.,LTD [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:99%min. Appearance:white powder Package:1kg/Export worthy packing; 25kg/drum Storage:In well-closed container, protected from light and in cool & dry place. Transportation:By Air, By Sea, By courier (door to door, DHL/FedEx/UPS) Application:R&D and production for pharmaceuticals and chemicals
Min. Order:1Gram
Supplier:LIDE PHARMACEUTICALS LIMITED [
China (Mainland)]
CAS No.55750-62-4 N[b-Maleimdopropxyloxy]succinimade ester
Assay:99% Appearance:Powder Package:according to the need of packing Storage:Inert atmosphere,2-8掳C Transportation:air sea or courier Application:intermediate
Min. Order:1Gram
Supplier:Shanghai Minstar Chemical Co., Ltd [
China (Mainland)]
CAS No.55750-62-4 3-(MaleiMido)propionic acid N-hydroxysucciniMide ester CAS NO.55750-62-4
Assay:99% Appearance:powder or liquid Package:according to customer requirements Storage:store in dry dark and ventilated place Transportation:By Sea/Air/Courier Application:It is an important raw material.
Min. Order:10Gram
Supplier:Zibo Hangyu Biotechnology Development Co., Ltd [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:99% Appearance:white crystalline powder Package:According to client's requirements Storage:keep sealed and keep from direct light Transportation:by sea/by air/by express Application:Used in pharmaceutical intermediates
Min. Order:10Kilogram
Supplier:Hangzhou ZeErRui Chemical Co., Ltd. [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:99.0% Appearance:Off-white to white powder Package:Grams, Kilograms Storage:Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials. Transportation:by sea or by air Application:intermediate
Min. Order:100Gram
Supplier:Chemlyte Solutions [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate CAS:55750-62-4
Assay:99% Appearance:Brown powder Package:According to customer requirements Storage:Avoid light, ventilation and shade Transportation:Sea or Air Application:It is an important raw material and intermediate
Min. Order:1Gram
Supplier:Qingdao Beluga Import and Export Co., LTD [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:99.00% Appearance:White Powder Package:25KG/Drum Storage:Preserve in tight, light-resistant containers Transportation:By Air& By Sea Application:Pharmaceutical
Min. Order:1Kilogram
Supplier:Golden Pharma Co., Limited [
China (Mainland)]
CAS No.55750-62-4 High quality N-Succinimidyl 3-maleimidopropionate supplier in China
Assay:99% Appearance:white-off solid or colorless liquid ( referto COA) Package:25kgs/fiber drum or 200kgs/UN drum Storage:in a cool and dry place Transportation:by sea or by air Application:Fine Intermediate
Min. Order:0Metric Ton
Supplier:Simagchem Corporation [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:99% Appearance:White fine powder Package:according to the clients requirement Transportation:Transportation by express, air, sea; port mainly to Qingdao / Tianjin / Shanghai, or according to customer needs to send different ports and aviation. Application:An important raw material and intermed
Min. Order:1Kilogram
Supplier:Shandong Hanjiang Chemical Co., Ltd. [
China (Mainland)]
CAS No.55750-62-4 BMPS N-SucciniMidyl 3-MaleiMidopropionate
Assay:99% Appearance:White Powder Package:25kg/drum, also according to the clients requirement Storage:Store In Dry, Cool And Ventilated Place Transportation:By Sea Or By Air Application:It is widely used as a thickener, emulsifier and stabilizer
Min. Order:1Kilogram
Supplier:EAST CHEMSOURCES LIMITED [
China (Mainland)]
CAS No.55750-62-4 55750-62-4 supplier in China
Assay:99% Appearance:white crystalline powder Package:100g/bottle,1kg/bottle,25kg/drum or as per your request Storage:Sealed in a cool ,dry and microtherm place , avoid light . Transportation:By express, air transportation or by sea transportation. Application:It is an important raw material and intermediate of synthetic drugs.
Min. Order:100Gram
Supplier:HANGZHOU YUNUO CHEMICAL CO.,LTD [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:NLT 98% Appearance:White powder Package:Aluminum bag/Carton Drum Storage:Store in a tightly closed container, in a cool and dry place. Transportation:By air Application:Used in producing API
Min. Order:0
Supplier:Hangzhou Huarong Pharm Co., Ltd. [
China (Mainland)]
CAS No.55750-62-4 BMPS N-SucciniMidyl 3-MaleiMidopropionate
Assay:98% Package:5kg 25kg According to clients' requirement Storage:Store in dry, dark and ventilated place Transportation:Sea/air/courier Application:Fenofibrate Intermediate
Min. Order:0Metric Ton
Supplier:Hangzhou Keyingchem Co.,Ltd [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:0.98 Appearance:Off white to slight yellow solid Package:1L 5L 10L 25L bottle Storage:Stored in shaded, cool and dry places Transportation:Handle with cares to avoid damaging the packages. Protect them from sunshine or rain. We can send by Fedex, by ship or by plane according to international rules. Application:pharma intermediate
Min. Order:0
Supplier:Antimex Chemical Limied [
China (Mainland)]
CAS No.55750-62-4 BMPS N-Succinimidyl 3-maleimidopropionate
Assay:98%, 99%, 99.5% Appearance:Refer to COA Package:According to clients' requirement Storage:Store in dry, cool and ventilated place Transportation:By sea or by air or by courier Application:As chemical reagents and etc.
Min. Order:0
Supplier:Hangzhou Ocean Chemical Co., Ltd. [
China (Mainland)]
CAS No.55750-62-4 N-succinimidyl 3-maleimidopropionate
Assay:99.90% Appearance:solid or liquid Package:drum and bag Storage:in sealed air resistant place Transportation:by sea or air Application:for pharma use
Min. Order:0
Supplier:Kono Chem Co.,Ltd [
China (Mainland)]
CAS No.55750-62-4 Succinimidyl 3-maleimidopropionate
Assay:99% Appearance:Solid Storage:Protect from light and keep dry Application:Pharmaceutical intermediates
Min. Order:0
Supplier:ORCHID CHEMICAL SUPPLIES LTD [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:98%min Package:25kg/drum,or as per customers'demand Transportation:air,sea,courier Application:API,or Intermediates,fine chemicals
Min. Order:0
Supplier:GIHI CHEMICALS CO.,LIMITED [
China (Mainland)]
CAS No.55750-62-4 BMPS
Assay:99%HPLC Appearance:Off white to white powder Application:Pharm intermediate
Min. Order:0
Supplier:HANGZHOU TIANYE CHEMICALS CO., LTD. [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:98% Application:For research use only.
Min. Order:0
Supplier:HEBEI SHENGSUAN CHEMICAL INDUSTRY CO.,LTD [
China (Mainland)]
CAS No.55750-62-4 1H-Pyrrole-1-propanoicacid, 2,5-dihydro-2,5-dioxo-, 2,5-dioxo-1-pyrrolidinyl ester
Assay:98%min Appearance:Off-white to light yellow powder Package:According to the clients requirement. Storage:Keep in cool place. Application:Pharmaceutical intermediates
Min. Order:0
Supplier:Hangzhou J&H Chemical Co., Ltd. [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionateCAS NO.:55750-62-4
Assay:99% Appearance:white powder Package:drum Storage:Room temperature Transportation:By Sea/Air/DHL Application:Pharmaceutical intermediates
Min. Order:1Gram
Supplier:Henan Wentao Chemical Product Co., Ltd. [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate manufacturer/supplier
Assay:99% Appearance:white or off-white powder Package:aluminum oil bag Storage:0~20鈩?nbsp;Transportation:by express,by sea, by air Application:N-Succinimidyl 3-maleimidopropionate CAS:55750-62-4 is used as API medicine
Min. Order:1Gram
Supplier:Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd [
China (Mainland)]
CAS No.55750-62-4 BMPS N-SucciniMidyl 3-MaleiMidopropionate
Assay:鈮?9.0% Appearance:White powder Package:25kg drum/bag Storage:Keep in dry and cool place Transportation:by Sea, air and express Application:銆?Use 1 銆? A nutritional supplement. One of the essential amino acids in the human body. Because the price is higher than DL-methionine and the effect is equal, DL-methionine is often used. 銆?Use
Min. Order:1Metric Ton
Supplier:KAISA GROUP INC [
United States]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:99% Package:box or opp package Storage:cool drum Transportation:air or sea Application:N-Succinimidyl 3-maleimidopropionate
Min. Order:1Milligram
Supplier:weifang yangxu group co.,ltd [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:99% Appearance:detailed see specifications Package:25kg/drum;200kg/drum Storage:Keep away of light, cool place Transportation:Sea/air/courier Application:Chemical synthesis
Min. Order:0
Supplier:Xiamen Hisunny Chemical Co.,Ltd [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:99 Appearance:powder, or liquid Package:Bottle, barrel, cargo, container, etc. Storage:Stored in room temperature, ventilated place Transportation:By air, ship, express, etc. Application:Pharmaceuticals, intermediates, APIs, custom synthesis, chemicals
Min. Order:0
Supplier:LEAP CHEM Co., Ltd. [
China (Mainland)]
CAS No.55750-62-4 BMPS
Assay:99% Appearance:white powder Package:25kg,50kg,180kg,200kg,250kg,1000kg锛宑ustomization Storage:Keep it in dry,shady and cool place Transportation:by express or by sea Application:Pharma;Industry;Agricultural;chemical reaserch
Min. Order:0
Supplier:Wuhan Circle Star Chem-medical Technology co.,Ltd. [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:COA Appearance:COA Storage:in stock Application:MSDS/TDS
Min. Order:0
Supplier:Aecochem Corp. [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:98% Application:For research use only.
Min. Order:0
Supplier:Hebei Jinshengzhongtai Industry Co.,Ltd [
China (Mainland)]
CAS No.55750-62-4 Pharmaceutical Grade CAS 55750-62-4 with competitive price
Assay:99% Appearance:White powder Package: [Packaging]20mg, 50mg,100mg,1g,10g,100g,according to customers' requirements Storage: should be stored in a well-closed container at low temperature, keep away from moisture, heat and light. Transportation:1. Samples 1kg-10kg are shipped by international express. 2. 50kg-100kg of goods are transported by dedicated line logistics. 3. Cargo 100kg-1ton is transported by dedicated line logistics. Application:Chemical raw materials, pharmaceutical intermediates, cosmetic raw materials, etc.
Min. Order:1Kilogram
Supplier:Zhuozhou Wenxi import and Export Co., Ltd [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:98% Appearance:detailed see specifications Package:according to the clients requirement Storage:Store in dry, dark and ventilated place Transportation:transport by sea or by air Application:Amines;Biotin Derivatives;Sulfur & Selenium Compounds;Chemical Synthesis; custom synthesis molecular; API Intermedia
Min. Order:1Gram
Supplier:Shanghai Massive Chemical Technology Co., Ltd. [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:99% Appearance:liquid or powder Package:according to the clients requirement Storage:Dry and Cool Place Transportation:UPS FedEx ,DHL,EXPRESS LINE Application:healing drugs
Min. Order:1Gram
Supplier:Shandong Mopai Biotechnology Co., LTD [
China (Mainland)]
CAS No.55750-62-4 BMPS N-SucciniMidyl 3-MaleiMidopropionate
Assay:99% Appearance:white powder Package:drum or based on customers' requirement Storage:normal temperature storage Transportation:by sea, by air Application:We have different specifications for different applications
Min. Order:1Metric Ton
Supplier:Bluecrystal chem-union [
China (Mainland)]
CAS No.55750-62-4 3-(MaleiMido)propionic acid N-hydroxysucciniMide ester
Assay:97% Appearance:Powder or liquid Package:According to customer Storage:Store in a tightly closed container, in a cool and dry place. Transportation:Fedex,DHL,TNT,BY SEA and BY AIR Application:Medicinal Chemistry Biomedicine Pharmaceutical intermediates Chemistry experiment Biological experiments Chemical reagent For R&D use only.
Min. Order:10Milligram
Supplier:Amadis Chemical Co., Ltd. [
China (Mainland)]
CAS No.55750-62-4 1-{3-[(2,5-Dioxo-1-pyrrolidinyl)-oxy]-3-oxopropyl}-1H-pyrrole-2,5-dione
Assay:99% Haccp,,Halal,SC US FDA GMP ISO14001 Appearance:As per Certificate of analysis and our TDS, MSDS Package:Export standard and according to the clients requirement Storage:Store in dry, dark and ventilated place;ISO / Kosher /GMP licence commercial bulk capacity factory in China Transportation:By AIR or by SEA GMP licence / US-FDA,South Korea-KFDA Application:It is an important raw material and intermediate for chemical industry.
Min. Order:5Kiloliter
Supplier:Chemwill Asia Co., Ltd. [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:鈮?8% Appearance:Liquid Package:Glass bottle or drum Storage:2-8鈩?nbsp;Transportation:RT Application:IMPURTY
Min. Order:50Milligram
Supplier:Shenzhen Regent Biochemistry Tech Co., Ltd. [
Hong Kong,China]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate CAS:55750-62-4
Assay:99% Appearance:White powder Package:25kg/drum Storage:Store in cool and dry place, away from sun light. Transportation:By sea or by air Application:Protein Crosslinker
Min. Order:1Kilogram
Supplier:Henan Sinotech Import&Export Corporation [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:99% Appearance:powder Package:1kg/bag; 101kg/drum, or as customer's required Storage:Keep in a cool & dry place Transportation:by air/by sea
Min. Order:0Metric Ton
Supplier:Jiangsu Congzhong Chemical Co., Ltd. [
China (Mainland)]
CAS No.55750-62-4 Acmec Succinimidyl 3-maleimidopropionate 10g
Assay:98% Appearance:See the datasheet Package:10g Storage:2-8掳C Transportation:By Express, Air and Road Application:Analytical reagent, biochemical reagent, standard
Min. Order:1bottle
Supplier:Shanghai Acmec Biochemical Technology Co., Ltd. [
China (Mainland)]
CAS No.55750-62-4 3-Maleimidopropionic Acid N-succinimidyl Ester
Assay:99.3% Appearance:white or Almost colorless Package:2.5kg or 5kg Transportation:Air freight, sea freight, and express delivery Application:Pharmaceutical intermediate
Min. Order:4Kilogram
Supplier:SHANGHAI T&W PHARMACEUTICAL CO., LTD. [
China (Mainland)]
CAS No.55750-62-4 Factory Supply N-succinimidyl 3-maleimidopropionate
Assay:99% Appearance:powder or granule ( refer to COA) Package:25kgs/fiber drum Storage:Keep in a cool & dry place Transportation:by sea or by air Application:Librium, Valium
Min. Order:0Metric Ton
Supplier:Ality Chemical Corporation [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:98%min Appearance:95%+ Package:R&D,Pilot run Transportation:per client require Application:Pharmaceutical Intermediates
Min. Order:0Metric Ton
Supplier:Hunan chemfish Pharmaceutical co.,Ltd [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:98% Appearance:solid or liquid Package:According to customer鈥榮 requirement Storage:Keep in a cool & dry place Application:Fine Intermediate
Min. Order:0
Supplier:Xiamen AmoyChem Co.,Ltd [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:97% Appearance:white to beige crystals Package:according to the clients requirement Storage:Room temperature with sealed well Transportation:by sea or by air Application:Use as primary and secondary intermediate
Min. Order:0
Supplier:BOC Sciences [
United States]
CAS No.55750-62-4 (BMPS);3-Maleimidopropionic acid NHS 55750-62-4
Assay:98% Appearance:solid or liquid Package:Foil bag; Drum; Plastic bottle Storage:in sealed air resistant place Transportation:by sea or air Application:Pharma;Industry;Agricultural
Min. Order:0
Supplier:Hunan Russell Chemicals Technology Co.,Ltd [
China (Mainland)]
CAS No.55750-62-4 N-succinimidyl 3-maleimidopropionate
Assay:99.90% Appearance:solid or liquid Package:drum and bag Storage:in sealed air resistant place Transportation:by sea or air Application:for pharma use
Min. Order:0
Supplier:Greenutra Resource Inc [
China (Mainland)]
CAS No.55750-62-4 3-Maleimidopropionic acid N-hydroxysuccinimide ester
Assay:98% Appearance:white powder Package:250mg Storage:Keep it in dry,shady and cool place Transportation:by express or by sea Application:Pharma;Industry;Agricultural;chemical reaserch
Min. Order:0
Supplier:Shanghai Yuanye Bio-Technology Co., Ltd. [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate cas no. 55750-62-4 98%
Assay:0.98 Package:Grams, Kilograms Transportation:According to customer request Application:For R&D
Min. Order:0
Supplier:Win-Win chemical Co.Ltd [
China (Mainland)]
CAS No.55750-62-4 BMPS N-Succinimidyl 3-maleimidopropionate
Assay:Pure Appearance:Powder Package:10G/bottle 1kg/tin 5kg/tin 25kg/carton Storage:Store in dry, cool and ventilated place Transportation:By sea By air By courier Application:Biology reagent
Min. Order:0
Supplier:Asure Biochem CO.,LTD. [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:98% Application:it's used for for pharmaceutical intermediates, organic chemicals
Min. Order:0
Supplier:SHANDONG BENRITE NEW CHEMICAL MATERIALS CO.,LTD. [
China (Mainland)]
CAS No.55750-62-4 N-Succinimidyl 3-maleimidopropionate
Assay:98% Application:For research use only.
Min. Order:0
Supplier:Qingdao Bravery International Trade Co., Ltd [
China (Mainland)]
CAS No.55750-62-4 N-SucciniMidyl 3-MaleiMidopropionate [Cross-linking Reagent]
Assay:98% Package:According to the demand of customer Storage:Sealed, dry, microtherm , avoid light and smell. Transportation:by air or by sea Application:Organic synthesis
Min. Order:0
Supplier:Henan Allgreen Chemical Co.,Ltd [
China (Mainland)]
- HENAN NEW BLUE CHEMICAL CO.,LTD
- Amadis Chemical Co., Ltd.

Other Product
- 23838-02-0/IRON(II) CHLORIDE N-HYDRATE
- 13517-10-7/BORON TRIIODIDE
- 12040-00-5/SAMARIUM TELLURIDE
- 12046-54-7/STRONTIUM BORIDE
- 71496-78-1/LANTHANUM ALUMINATE
- 393-85-1/2-NITRO-5-FLUOROBENZOIC ACID, METHYL ESTER
- 169396-88-7/N-[2-(FMOC-AMINO)-ETHYL]GLYCINE TERT-BUTYL ESTER HYDROCHLORIDE
- 166108-71-0/[2-[2-(Fmoc-amino)ethoxy]ethoxy]acetic acid
- 78539-91-0/7-METHYL-1,2,3-TRIAZOLO(1,5-A)PYRIDINE
- 72648-80-7/ETHYL [2-(BOC-AMINO)ETHYLAMINO]ACETATE HYDROCHLORIDE
- 169287-77-8/BOC-PNA-G(Z)-OH
- 947-88-6/3-(2-PYRIDYL)-1,2,3-TRIAZOLO(1,5-A)PYRIDINE
- 2032-75-9/2,2-Dichloro-1,3-benzodioxole
- 27428-57-5/4-BROMO-4'-CHLOROBENZOPHENONE
- 32665-23-9/FEMA 2961
- 5892-11-5/BRUCINE
- 55750-62-4/N-Succinimidyl 3-maleimidopropionate
- 209127-01-5/1-(4-Fluorphenyl)-2-methyl-2-morpholino-1-propanone
- 15445-77-9/FMOC-ARG(PBF)-OH
- 129121-73-9/ALPHA-CGRP (8-37) (RAT)
- 92000-76-5/HA PEPTIDE
- 125911-68-4/SAMS PEPTIDE
- 73572-58-4/BOC-PHE-D-LEU-PHE-D-LEU-PHE-OH
- 187986-11-4/H-TRP-LYS-TYR-MET-VAL-MET-NH2
- 10010-67-0/Sodium hydrogen piperazine-1,4-diethanesulphonate
- 100930-02-7/ARG-TYR-LEU-PRO-THR ACETATE SALT
- 183598-56-3/LEPTIN (22-56), HUMAN
- 357952-10-4/FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
- 102029-74-3/H-TYR-PRO-PHE-VAL-GLU-PRO-ILE-OH
- 217082-58-1/GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE