Home Product About us Contact Link Make Me Home Page Add to favorite
Welcome to Lookchemical  |  Purchasing Requirment
Current position:Home >Product >

URODILATIN HUMAN

URODILATIN HUMAN(115966-23-9)

  • Name: URODILATIN HUMAN
  • Synonyms:THR-ALA-PRO-ARG-ANP, HUMAN;THR-ALA-PRO-ARG-ATRIAL NATRIURETIC FACTOR (1-28) (HUMAN);THR-ALA-PRO-ARG-ATRIAL NATRIURETIC PEPTIDE;THR-ALA-PRO-ARG-ATRIAL NATRIURETIC PEPTIDE HUMAN;THR-ALA-PRO-ARG-SER-LEU-ARG-ARG-SER-SER-CYS-PHE-GLY-GLY-ARG-MET-ASP-ARG-ILE-GLY-ALA-GLN-SER-GLY-LEU-GLY-CYS-ASN-SER-PHE-ARG-TYR;TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (DISULFIDE BRIDGE: 11-27);URODILATIN;URODILATIN (95-126)
  • Molecular Formula:Unspecified
  • Molecular Weight:3505.93
  • CAS Registry Number:115966-23-9
  • EINECS:
  • Melting Point:
  • Water Solubility:

The Complete List of Suppliers for URODILATIN HUMAN

    CAS No.115966-23-9 URODILATIN HUMAN

    Assay:99% Appearance:powder Package:Inside plastic outside Storage:Store at -20掳C Transportation:We ship goods via DHL, Fedex, UPS, TNT, China post, NL Post and other couriers, weight from 1g to 1000kg or even bulker Application:Scientific research 

    Min. Order:1Gram

    Supplier:Hebei Nengqian Chemical Import and Export Co., LTD [ China (Mainland)]

    CAS No.115966-23-9 Urodilatin

    Assay:99% Appearance:powder or liquid Package:according to customer requirements Storage:store in dry dark and ventilated place Transportation:By Sea/Air/Courier Application:It is an important raw material. 

    Min. Order:10Gram

    Supplier:Zibo Hangyu Biotechnology Development Co., Ltd [ China (Mainland)]

    CAS No.115966-23-9 URODILATIN HUMAN

    Assay:90%,98% Appearance:detailed see specifications Package:according to the clients requirement Storage:Store in dry, dark and ventilated place. Transportation:by air or by sea Application:Used in Synthesis, Pharmaceuticals and other fields 

    Min. Order:1Kilogram

    Supplier:Dayang Chem (Hangzhou) Co.,Ltd. [ China (Mainland)]

    CAS No.115966-23-9 Urodilatin

    Assay:99.0% Appearance:liquid Package:Grams, Kilograms Storage:Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials. Transportation:According to customer request Application:For R&D and commerical use 

    Min. Order:100Gram

    Supplier:Chemlyte Solutions [ China (Mainland)]

    CAS No.115966-23-9 URODILATIN HUMAN

    Assay: 98%Min Appearance:Detailed in specifications Package:According to customer  Storage:Store in dry, dark and ventilated place Transportation:By air or by sea  Application:An important raw material and intermediate used in organic Synthesis, Pharmaceuticals  

    Min. Order:1Kilogram

    Supplier:TAIZHOU ZHENYU BIOTECHNOLOGY CO., LTD [ China (Mainland)]

    CAS No.115966-23-9 Urodilatin

    Assay:99% Application:healing drugs 

    Min. Order:0

    Supplier:Antimex Chemical Limied [ China (Mainland)]

    CAS No.115966-23-9 Urodilatin

    Assay:98%min Appearance:Off-white to light yellow powder Package:According to the clients requirement. Storage:Keep in cool place. Application:Pharmaceutical intermediates 

    Min. Order:0

    Supplier:Hangzhou J&H Chemical Co., Ltd. [ China (Mainland)]

    CAS No.115966-23-9 URODILATIN HUMAN

    Assay:99%+ Package:25kg,50kg,180kg,200kg,250kg,1000kg锛宑ustomization Storage:Keep it in dry,shady and cool place Transportation:Transit could be DHL,UPS,TNT,EMS,Fedex,and so on. For mass orders, it will be delivered by air or sea. For small order, please expect 3-7 days by UPS DHL EMS. For mass order, please allow 5-8 days. Application:Pharma;Industry;Agricultural;chemical reaserch 

    Min. Order:1Kilogram

    Supplier:Wuhan Circle Star Chem-medical Technology co.,Ltd. [ China (Mainland)]

    CAS No.115966-23-9 URODILATIN HUMAN

    Assay:99% Package:box or opp package Storage:cool drum  Transportation:air or sea Application:URODILATIN HUMAN 

    Min. Order:1Milligram

    Supplier:weifang yangxu group co.,ltd [ China (Mainland)]

    CAS No.115966-23-9 Urodilatin

    Assay:99% Package:drum Transportation:By Sea/Air/DHL Application:Henan Wentao Chemical Product Co., Ltd. 

    Min. Order:0

    Supplier:Henan Wentao Chemical Product Co., Ltd. [ China (Mainland)]

    CAS No.115966-23-9 URODILATIN HUMAN

    Assay:99.90% Appearance:solid or liquid Package:Foil bag; Drum; Plastic bottle Storage:in sealed air resistant place Transportation:by sea or air Application:Pharma;Industry;Agricultural 

    Min. Order:0

    Supplier:Xi`an Eastling Biotech Co., Ltd. [ China (Mainland)]

    CAS No.115966-23-9 Manufacturer supply CAS 115966-23-9 with best quality

    Assay:99% Appearance:White powder Package: [Packaging]20mg, 50mg,100mg,1g,10g,100g,according to customers' requirements Storage: should be stored in a well-closed container at low temperature, keep away from moisture, heat and light. Transportation:1. Samples 1kg-10kg are shipped by international express. 2. 50kg-100kg of goods are transported by dedicated line logistics. 3. Cargo 100kg-1ton is transported by dedicated line logistics. Application:Chemical raw materials, pharmaceutical intermediates, cosmetic raw materials, etc. 

    Min. Order:1Kilogram

    Supplier:Zhuozhou Wenxi import and Export Co., Ltd [ China (Mainland)]

    CAS No.115966-23-9 Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine)

    Assay:99% Appearance:powder Package:1kg/bag; 101kg/drum, or as customer's required Storage:Keep in a cool & dry place Transportation:by air/by sea 

    Min. Order:0Metric Ton

    Supplier:Jiangsu Congzhong Chemical Co., Ltd. [ China (Mainland)]

    CAS No.115966-23-9 115966-23-9

    Assay:98.5% Appearance:white/off-white or light yellow Package:aluminum bottle,glass bottle,PTFE bottle,cardboard drum Storage:Store in cool and dry place, keep away from strong light and heat. Transportation:by courier, by air, by sea Application:This product can be used in food/pharmaceutical/cosmetical industry 

    Min. Order:0

    Supplier:Suzhou Health Chemicals Co., Ltd. [ China (Mainland)]

    CAS No.115966-23-9 Ularitide

    Assay:鈮?8% by HPLC Appearance:White Powder Storage:Store at -20掳C Application:For research use only. 

    Min. Order:0

    Supplier:BOC Sciences [ United States]

    CAS No.115966-23-9 URODILATIN HUMAN

    Assay:98% Package:According to the demand of customer Storage:Sealed, dry, microtherm , avoid light and smell. Transportation:by air or by sea Application:Organic synthesis 

    Min. Order:0

    Supplier:Henan Allgreen Chemical Co.,Ltd [ China (Mainland)]

Purchasing Requirement

Other Product

Home - Product - About us - Contact us - Link - Make Me Home Page - Add to favorite
Listings:  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 1 2 3 4 5 6 7 8 9 0
CAS  No:  1 2 3 4 5 6 7 8 9
Copyright©2010 LookChemical Group Ltd. All Rights Reserved. No authorized Reproduction or Duplication of Any Kind. 621-59-0 25154-85-2
浙ICP备16009103号