ALPHA-ENDORPHIN(59004-96-5)
- Name: ALPHA-ENDORPHIN
- Synonyms:154: PN: WO0069900SEQID: 819 unclaimed sequence;155: PN: WO0069900 SEQID: 820 unclaimedsequence;15: PN: WO2008008805 SEQID: 15 unclaimed protein;17: PN:US20010010919 SEQID: 8 unclaimed sequence;185: PN: US20060293232 PAGE: 16unclaimed sequence;20: PN: WO2009012472 SEQID: 20 unclaimed sequence;22: PN:WO2006068768 SEQID: 20 claimed sequence;232: PN: WO2007106799 SEQID: 291unclaimed sequence;293: PN: US20090048431 SEQID: 291 claimed sequence;486:PN: US20080312157 SEQID: 550 unclaimed sequence;61-76-β-Lipotropin (sheep);64: PN:US20090104234 SEQID: 64 unclaimed protein;666: PN: US20090175821 SEQID: 819claimed protein;Human β-endorphin-(1-16);L-Threonine,L-tyrosylglycylglycyl-L-phenylalanyl-L-methionyl-L-threonyl-L-seryl-L-a-glutamyl-L-lysyl-L-seryl-L-glutaminyl-L-threonyl-L-prolyl-L-leucyl-L-valyl-;Porcine α-endorphin;α-Endorphin (human);α-Endorphin (pig);α-Endorphin (porcine);
- Molecular Formula:C77H120N18O26S
- Molecular Weight:1745.97
- CAS Registry Number:59004-96-5
- EINECS:262-330-3
- Melting Point:
- Water Solubility:
CAS No.59004-96-5 ALPHA-ENDORPHIN
Assay:99% Package:According client's requirements Transportation:by sea/by air/by courier Application:Chemical products
Min. Order:1Kilogram
Supplier:Hangzhou ZeErRui Chemical Co., Ltd. [
China (Mainland)] CAS No.59004-96-5 ALPHA-ENDORPHIN
Assay:99% Appearance:powder Package:Inside plastic outside Storage:Store at -20掳C Transportation:We ship goods via DHL, Fedex, UPS, TNT, China post, NL Post and other couriers, weight from 1g to 1000kg or even bulker Application:Scientific research
Min. Order:1Gram
Supplier:Hebei Nengqian Chemical Import and Export Co., LTD [
China (Mainland)] CAS No.59004-96-5 尾-Endorphin, human;YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Assay:99% Appearance:powder or liquid Package:according to customer requirements Storage:store in dry dark and ventilated place Transportation:By Sea/Air/Courier Application:It is an important raw material.
Min. Order:10Gram
Supplier:Zibo Hangyu Biotechnology Development Co., Ltd [
China (Mainland)] CAS No.59004-96-5 尾-Endorphin, human;YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Assay:99.0% Appearance:liquid Package:Grams, Kilograms Storage:Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials. Transportation:According to customer request Application:For R&D and commerical use
Min. Order:100Gram
Supplier:Chemlyte Solutions [
China (Mainland)] CAS No.59004-96-5 伪-ENDORPHIN
Assay:99% Appearance:White fine powder Package:according to the clients requirement Transportation:Transportation by express, air, sea; port mainly to Qingdao / Tianjin / Shanghai, or according to customer needs to send different ports and aviation. Application:Used as pharmaceutical intermediate
Min. Order:1Kilogram
Supplier:Shandong Hanjiang Chemical Co., Ltd. [
China (Mainland)] CAS No.59004-96-5 ALPHA-ENDORPHIN
Assay:99% Appearance:Powder Package:According to customer requirements Storage:dry and cool Transportation:Air and sea transportation Application:Pharmaceutical Industry
Min. Order:1Kilogram
Supplier:GIHI CHEMICALS CO.,LIMITED [
China (Mainland)] CAS No.59004-96-5 Newblue-CHEM ALPHA-ENDORPHIN
Assay:99% Appearance:white powder Package:200KG Storage:room temperature Transportation:By sea , by air or express Application:Industrial Grade
Min. Order:1Kilogram
Supplier:HENAN NEW BLUE CHEMICAL CO.,LTD [
China (Mainland)] CAS No.59004-96-5 alpha-Endorphin (sheep)
Assay:98%Min Appearance:detailed see specifications Package:according to the clients requirement Storage:Store in dry, dark and ventilated place. Transportation:by ocean shipping or clients requirement Application:An important raw material and intermediate used in Organic Synthesis, Pharmaceuticals
Min. Order:0
Supplier:Dayang Chem (Hangzhou) Co.,Ltd. [
China (Mainland)] CAS No.59004-96-5 ALPHA-ENDORPHIN
Assay:white powder Appearance:Keep it in dry,shady and cool place Package:Transit could be DHL,UPS,TNT,EMS,Fedex,and so on. For mass orders, it will be delivered by air or sea. For small order, please expect 3-7 days by UPS DHL EMS. For mass order, please allow 5-8 days... Storage:Pharma;Industry;Agricultural;chemical reaserch Transportation:Any port in China Application:25kg,50kg,180kg,200kg,250kg,1000kg锛宑ustomization
Min. Order:0
Supplier:TAIZHOU ZHENYU BIOTECHNOLOGY CO., LTD [
China (Mainland)] CAS No.59004-96-5 ALPHA-ENDORPHIN
Assay:HPLC鈮?8% Appearance:powder Storage:Sealed in dry,Room Temperature Transportation:by express or by sea Application:for pharma use
Min. Order:0
Supplier:Hangzhou Shanyi Biotechnology Co., Ltd. [
China (Mainland)] CAS No.59004-96-5 alpha-endorphin
Assay:99.90% Appearance:solid or liquid Package:drum and bag Storage:in sealed air resistant place Transportation:by sea or air Application:for pharma use
Min. Order:0
Supplier:Kono Chem Co.,Ltd [
China (Mainland)] CAS No.59004-96-5 伪-Endorphin (sheep)
Assay:99% Application:Fine chemical intermediates, used as the main raw material for he synthesis of various pesticides, medicines, surfactants, polymer monomers, Ond Ontifungal agents
Min. Order:0
Supplier:Antimex Chemical Limied [
China (Mainland)] CAS No.59004-96-5 ALPHA-ENDORPHIN
Assay:99% Application:Medical research field
Min. Order:0
Supplier:Qingdao Beluga Import and Export Co., LTD [
China (Mainland)] CAS No.59004-96-5 ALPHA-ENDORPHIN
Min. Order:0
Supplier:Jinxin Shengda Air Freight Forwarding (Huizhou City) Co., LTD [
China (Mainland)] CAS No.59004-96-5 ALPHA-ENDORPHIN
Assay:97% Appearance:powder Package:As requested Storage:-20掳C Transportation:By air or by sea Application:59004-96-5
Min. Order:1Kilogram
Supplier:HENAN SUNLAKE ENTERPRISE CORPORATION [
China (Mainland)] CAS No.59004-96-5 ALPHA-ENDORPHIN
Assay:99%+ Appearance:White to Off-White Solid Package:as your requirement Storage:Keep it in dry,shady and cool place Transportation:Transit could be DHL,UPS,TNT,EMS,Fedex,and so on.For mass orders, it will be delivered by air or sea.For small order, please expect 3-7 days by UPS DHL EMS.For mass order, please allow 5-8 days. Application:Pharma;Industry;Agricultural;chemical reaserch
Min. Order:1Kilogram
Supplier:Wuhan Circle Star Chem-medical Technology co.,Ltd. [
China (Mainland)] CAS No.59004-96-5 ALPHA-ENDORPHIN
Assay:99.0% min Appearance:Highest quality appearance Package:25kgs/drum锛?00kg/drum锛汭BC TANK Storage:Keep in dry and well ventilated warehouse, keep sealed Transportation:By air and by sea Application:Extremely good quality, widely used in Pharmaceutical Industry, Food Industry, agricultural industry etc.
Min. Order:1Kilogram
Supplier:Hangzhou Johoo Chemical Co., Ltd [
China (Mainland)] CAS No.59004-96-5 ALPHA-ENDORPHIN
Assay:99% Package:box or opp package Storage:cool drum Transportation:air or sea Application:ALPHA-ENDORPHIN
Min. Order:1Milligram
Supplier:weifang yangxu group co.,ltd [
China (Mainland)] CAS No.59004-96-5 ALPHA-ENDORPHIN
Assay:98% Appearance:Transparent to light yellow liquid Package:Safe Packaging Storage:Store in RT Transportation:By sea or air as request Application:api
Min. Order:1Kilogram
Supplier:Hubei Shengliyuan New Materials Co., Ltd [
China (Mainland)] CAS No.59004-96-5 ALPHA-ENDORPHIN
Assay:98% Package:25 kgs Packed in Drum,small order in carton Packing Storage:Store in cool and dry place, away from Sun light. Transportation:By Express,By Sea or by Air Application:healing drugs
Min. Order:1Kilogram
Supplier:Xi'an HDM Biotech Co., Ltd. [
China (Mainland)] CAS No.59004-96-5 ALPHA-ENDORPHIN
Assay:HPLC鈮?8% Appearance:powder Storage:In cool ,dry place Transportation:Air or sea freight Application:for pharma use
Min. Order:0
Supplier:KAISA GROUP INC [
United States] CAS No.59004-96-5 伪-Endorphin (sheep)
Assay:99% Appearance:liquid or powder Package:according to the clients requirement Storage:Dry and Cool Place Transportation:UPS FedEx ,DHL,EXPRESS LINE Application:API
Min. Order:1Gram
Supplier:Shandong Mopai Biotechnology Co., LTD [
China (Mainland)] CAS No.59004-96-5 ALPHA-ENDORPHIN
Assay:99% Min Appearance:white powder Package:1kg/Aluminum foil bag with one plastic-bags inside.10kg/Carton Box with plastic-bags inside.25kg/Paper-drum with two plastic-bags inside. Storage:in sealed air resistant place Transportation:by air, by sea, cargo Application:healing drugs
Min. Order:1Metric Ton
Supplier:Falcon Life Sciences Pvt. Ltd [
China (Mainland)] CAS No.59004-96-5 alpha-Endorphin (sheep)
Assay:98.5% Appearance:white/off-white or light yellow Package:aluminum bottle,glass bottle,PTFE bottle,cardboard drum Storage:Store in cool and dry place, keep away from strong light and heat. Transportation:by courier, by air, by sea Application:This product can be used in food/pharmaceutical/cosmetical industry
Min. Order:0
Supplier:Suzhou Health Chemicals Co., Ltd. [
China (Mainland)] CAS No.59004-96-5 伪-Endorphin human manufacturer
Assay:鈮?7% (HPLC) Appearance:White powder Package:According client's requirements Storage:keep sealed and keep from direct light Transportation:According client's requirements Application:pharmaceutical
Min. Order:0
Supplier:Shanghai Yuanye Bio-Technology Co., Ltd. [
China (Mainland)] CAS No.59004-96-5 alpha-Endorphin
Assay:鈮?5% Appearance:Powder Storage:Store at -20掳C Application:Neurotransmitter Agents
Min. Order:0
Supplier:BOC Sciences [
United States] CAS No.59004-96-5 ALPHA-ENDORPHIN
Assay:98% Package:According to the demand of customer Storage:Sealed, dry, microtherm , avoid light and smell. Transportation:by air or by sea Application:Organic synthesis
Min. Order:0
Supplier:Henan Allgreen Chemical Co.,Ltd [
China (Mainland)]
Other Product
- 41916-65-8/Carbonohydrazonicdifluoride (9CI)
- 6943-55-1/2-(4-nitrophenyl)diazenylpropan-2-yl acetate
- 55868-69-4/3,4-dichlorobenzyl 2,2-dimethyl-3-(2-methylprop-1-en-1-yl)cyclopropanecarboxylate
- 69603-92-5/S-[2-(4,6-dimethylpyridin-2-yl)ethyl] hydrogen sulfurothioate
- 73507-26-3/Cuprate(5-),[2-[[4-chloro-6-[methyl(2-methyl-5-sulfophenyl)amino]-1,3,5-triazin-2-yl]amino]-6-[[4-[(2,5-disulfophenyl)azo]-2-hydroxy-5-methylphenyl]azo]-5-hydroxy-1,7-naphthalenedisulfonato(7-)]-,pentasodium (9CI)
- 1069-57-4/Guanidine, compound with nitrosopropanedinitrile (1:1)
- 5200-57-7/4-[(E)-(4-aminophenyl)diarsenyl]benzenesulfonamide
- 32899-77-7/DL-Glutamic acid, 4-(1-piperidinyl)-, diastereomer A
- 21711-00-2/2-cyclohexyl-3-phenyloxaziridine
- 152832-13-8/6-BENZO[A]PYRENYLISOTHIOCYANATE
- 67318-13-2/ethyl 5-{[ethoxy(oxo)acetyl]amino}furan-2-carboxylate
- 477-67-8/5,6,7,8-Tetrahydro-8β-hydroxy-7α-(hydroxymethyl)-5β-(3,4,5-trimethoxyphenyl)naphtho[2,3-d]-1,3-dioxole-6α-carboxylic acid
- 68384-85-0/diethyl 2-oxo-3-(2-oxopropyl)butanedioate
- 68954-01-8/1,2,4,5-Benzenetetracarboxylicacid, mixed 3-chloro-2-hydroxypropyl and g-w-perfluoro-C8-14-alkyl esters
- 80345-36-4/2,6-dibromo-9-thiabicyclo[3.3.1]nonane 9,9-dioxide
- 77547-07-0/5-BENZYL-3-METHYLENE-DIHYDRO-FURAN-2-ONE
- 101843-84-9/b-D-Glucopyranoside, (3b,6a,16b,20R,24S)-3-[[4-O-acetyl-2-O-(6-deoxy-a-L-mannopyranosyl)-b-D-xylopyranosyl]oxy]-20,24-epoxy-16,25-dihydroxy-9,19-cyclolanostan-6-yl
- 30001-28-6/Benzenemethanamine,2-(methylamino)-, hydrochloride (1:2)
- 59004-96-5/ALPHA-ENDORPHIN
- 102129-33-9/Piperidine,1-[2-[4,5-dihydro-5-(5-methyl-2-furanyl)-1-phenyl-1H-pyrazol-3-yl]ethyl]-,hydrochloride (1:1)
- 7167-16-0/2-({5-[(2,3-dihydro-1H-inden-5-yloxy)methyl]furan-2-yl}carbonyl)-N-(3-morpholin-4-ylpropyl)hydrazinecarbothioamide
- 94891-28-8/Liquidambarstyraciflua, ext.
- 61114-40-7/2-(3-CHLORO-PHENYL)-CYCLOPROPYLAMINE
- 93456-03-2/Samadera indica, ext.
- 7145-70-2/1-(hydroxymethyl)-9H-fluoren-9-ol
- 71701-26-3/N-[4-[(2-hydroxy-5-methylphenyl)azo]phenyl]benzamide
- 25757-56-6/Phosphoramidimidicdichloride (8CI,9CI)
- 2265-04-5/4,4,4-trifluoro-1-(3-hydroxy-10,13-dimethyl-2,3,4,7,8,9,10,11,12,13,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthren-17-yl)butane-1,3-dione (non-preferred name)
- 6174-92-1/2-Propenoic acid,2,3-dimethoxy-, ethyl ester
- 7479-48-3/(2E)-2-(2,2-dimethylcyclohexylidene)hydrazinecarboxamide